SIRPG purified MaxPab mouse polyclonal antibody (B01P)
  • SIRPG purified MaxPab mouse polyclonal antibody (B01P)

SIRPG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055423-B01P
SIRPG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIRPG protein.
Información adicional
Size 50 ug
Gene Name SIRPG
Gene Alias CD172g|SIRP-B2|SIRPB2|SIRPgamma|bA77C3.1
Gene Description signal-regulatory protein gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRPG (NP_061026.2, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55423

Enviar un mensaje


SIRPG purified MaxPab mouse polyclonal antibody (B01P)

SIRPG purified MaxPab mouse polyclonal antibody (B01P)