STYK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • STYK1 purified MaxPab rabbit polyclonal antibody (D01P)

STYK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055359-D01P
STYK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STYK1 protein.
Información adicional
Size 100 ug
Gene Name STYK1
Gene Alias DKFZp761P1010|NOK|SuRTK106
Gene Description serine/threonine/tyrosine kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLGFLWTCRRDVMTMDGLLYDLTEKQVYHIGKQVLLALEFLQEKHLFHGDVAAR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STYK1 (NP_060893.1, 1 a.a. ~ 422 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55359

Enviar un mensaje


STYK1 purified MaxPab rabbit polyclonal antibody (D01P)

STYK1 purified MaxPab rabbit polyclonal antibody (D01P)