STK32B monoclonal antibody (M01), clone 4A7
  • STK32B monoclonal antibody (M01), clone 4A7

STK32B monoclonal antibody (M01), clone 4A7

Ref: AB-H00055351-M01
STK32B monoclonal antibody (M01), clone 4A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STK32B.
Información adicional
Size 100 ug
Gene Name STK32B
Gene Alias HSA250839|STK32|STKG6|YANK2
Gene Description serine/threonine kinase 32B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq ELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGHLQHCLETVREEFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK32B (AAH38238, 314 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55351
Clone Number 4A7
Iso type IgG2b Kappa

Enviar un mensaje


STK32B monoclonal antibody (M01), clone 4A7

STK32B monoclonal antibody (M01), clone 4A7