STK32B MaxPab mouse polyclonal antibody (B01P)
  • STK32B MaxPab mouse polyclonal antibody (B01P)

STK32B MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055351-B01P
STK32B MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STK32B protein.
Información adicional
Size 50 ug
Gene Name STK32B
Gene Alias HSA250839|STK32|STKG6|YANK2
Gene Description serine/threonine kinase 32B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCIERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHITDFNIATVVKGAERASSMAGTKPYMAPEVFQVYMDGGPGYSYPVDWWSLGITAYELLRGWRPYEIHSVTPIDEILNMFKVERVHYSSTWCKGM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK32B (AAH38238.1, 1 a.a. ~ 414 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55351

Enviar un mensaje


STK32B MaxPab mouse polyclonal antibody (B01P)

STK32B MaxPab mouse polyclonal antibody (B01P)