GIMAP5 monoclonal antibody (M14A), clone 3F11
  • GIMAP5 monoclonal antibody (M14A), clone 3F11

GIMAP5 monoclonal antibody (M14A), clone 3F11

Ref: AB-H00055340-M14A
GIMAP5 monoclonal antibody (M14A), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GIMAP5.
Información adicional
Size 200 uL
Gene Name GIMAP5
Gene Alias FLJ11296|HIMAP3|IAN4|IAN4L1|IAN5|IMAP3|hIAN5
Gene Description GTPase, IMAP family member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPAFESKLRAQSVTRTCQVKTGTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GIMAP5 (AAH11732, 1 a.a. ~ 307 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 55340
Clone Number 3F11
Iso type IgM Kappa

Enviar un mensaje


GIMAP5 monoclonal antibody (M14A), clone 3F11

GIMAP5 monoclonal antibody (M14A), clone 3F11