GIMAP5 MaxPab rabbit polyclonal antibody (D01)
  • GIMAP5 MaxPab rabbit polyclonal antibody (D01)

GIMAP5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055340-D01
GIMAP5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GIMAP5 protein.
Información adicional
Size 100 uL
Gene Name GIMAP5
Gene Alias FLJ11296|HIMAP3|IAN4|IAN4L1|IAN5|IMAP3|hIAN5
Gene Description GTPase, IMAP family member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GIMAP5 (NP_060854.2, 1 a.a. ~ 307 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55340

Enviar un mensaje


GIMAP5 MaxPab rabbit polyclonal antibody (D01)

GIMAP5 MaxPab rabbit polyclonal antibody (D01)