FBXL8 MaxPab rabbit polyclonal antibody (D01)
  • FBXL8 MaxPab rabbit polyclonal antibody (D01)

FBXL8 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055336-D01
FBXL8 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FBXL8 protein.
Información adicional
Size 100 uL
Gene Name FBXL8
Gene Alias FBL8|FLJ11278|MGC19959
Gene Description F-box and leucine-rich repeat protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXL8 (NP_060848.2, 1 a.a. ~ 374 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55336

Enviar un mensaje


FBXL8 MaxPab rabbit polyclonal antibody (D01)

FBXL8 MaxPab rabbit polyclonal antibody (D01)