GIMAP4 monoclonal antibody (M05), clone 1D8
  • GIMAP4 monoclonal antibody (M05), clone 1D8

GIMAP4 monoclonal antibody (M05), clone 1D8

Ref: AB-H00055303-M05
GIMAP4 monoclonal antibody (M05), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GIMAP4.
Información adicional
Size 100 ug
Gene Name GIMAP4
Gene Alias FLJ11110|HIMAP4|IAN1|IMAP4|MSTP062|hIAN1
Gene Description GTPase, IMAP family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RYTEEEHKATEKILKMFGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GIMAP4 (NP_060796, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55303
Clone Number 1D8
Iso type IgG1

Enviar un mensaje


GIMAP4 monoclonal antibody (M05), clone 1D8

GIMAP4 monoclonal antibody (M05), clone 1D8