GIMAP4 polyclonal antibody (A01)
  • GIMAP4 polyclonal antibody (A01)

GIMAP4 polyclonal antibody (A01)

Ref: AB-H00055303-A01
GIMAP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GIMAP4.
Información adicional
Size 50 uL
Gene Name GIMAP4
Gene Alias FLJ11110|HIMAP4|IAN1|IMAP4|MSTP062|hIAN1
Gene Description GTPase, IMAP family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq RYTEEEHKATEKILKMFGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GIMAP4 (NP_060796, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55303

Enviar un mensaje


GIMAP4 polyclonal antibody (A01)

GIMAP4 polyclonal antibody (A01)