FBXW7 polyclonal antibody (A01)
  • FBXW7 polyclonal antibody (A01)

FBXW7 polyclonal antibody (A01)

Ref: AB-H00055294-A01
FBXW7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXW7.
Información adicional
Size 50 uL
Gene Name FBXW7
Gene Alias AGO|CDC4|DKFZp686F23254|FBW6|FBW7|FBX30|FBXO30|FBXW6|FLJ16457|SEL-10|SEL10
Gene Description F-box and WD repeat domain containing 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55294

Enviar un mensaje


FBXW7 polyclonal antibody (A01)

FBXW7 polyclonal antibody (A01)