BRF2 polyclonal antibody (A01)
  • BRF2 polyclonal antibody (A01)

BRF2 polyclonal antibody (A01)

Ref: AB-H00055290-A01
BRF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BRF2.
Información adicional
Size 50 uL
Gene Name BRF2
Gene Alias BRFU|FLJ11052|TFIIIB50
Gene Description BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRF2 (NP_060780, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55290

Enviar un mensaje


BRF2 polyclonal antibody (A01)

BRF2 polyclonal antibody (A01)