UBE2W monoclonal antibody (M01), clone 7G4
  • UBE2W monoclonal antibody (M01), clone 7G4

UBE2W monoclonal antibody (M01), clone 7G4

Ref: AB-H00055284-M01
UBE2W monoclonal antibody (M01), clone 7G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2W.
Información adicional
Size 100 ug
Gene Name UBE2W
Gene Alias FLJ11011|hUBC-16
Gene Description ubiquitin-conjugating enzyme E2W (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2W (NP_001001481, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55284
Clone Number 7G4
Iso type IgG2a Kappa

Enviar un mensaje


UBE2W monoclonal antibody (M01), clone 7G4

UBE2W monoclonal antibody (M01), clone 7G4