UBE2W polyclonal antibody (A01)
  • UBE2W polyclonal antibody (A01)

UBE2W polyclonal antibody (A01)

Ref: AB-H00055284-A01
UBE2W polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE2W.
Información adicional
Size 50 uL
Gene Name UBE2W
Gene Alias FLJ11011|hUBC-16
Gene Description ubiquitin-conjugating enzyme E2W (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2W (NP_001001481, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55284

Enviar un mensaje


UBE2W polyclonal antibody (A01)

UBE2W polyclonal antibody (A01)