FLJ10986 polyclonal antibody (A01)
  • FLJ10986 polyclonal antibody (A01)

FLJ10986 polyclonal antibody (A01)

Ref: AB-H00055277-A01
FLJ10986 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FLJ10986.
Información adicional
Size 50 uL
Gene Name FGGY
Gene Alias FLJ10986
Gene Description FGGY carbohydrate kinase domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLJ10986 (NP_060761, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55277

Enviar un mensaje


FLJ10986 polyclonal antibody (A01)

FLJ10986 polyclonal antibody (A01)