PGM2 monoclonal antibody (M05), clone 1A3
  • PGM2 monoclonal antibody (M05), clone 1A3

PGM2 monoclonal antibody (M05), clone 1A3

Ref: AB-H00055276-M05
PGM2 monoclonal antibody (M05), clone 1A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PGM2.
Información adicional
Size 100 ug
Gene Name PGM2
Gene Alias FLJ10983|MSTP006
Gene Description phosphoglucomutase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGM2 (AAH10087.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55276
Clone Number 1A3
Iso type IgG2a Kappa

Enviar un mensaje


PGM2 monoclonal antibody (M05), clone 1A3

PGM2 monoclonal antibody (M05), clone 1A3