PHF10 MaxPab rabbit polyclonal antibody (D01)
  • PHF10 MaxPab rabbit polyclonal antibody (D01)

PHF10 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055274-D01
PHF10 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PHF10 protein.
Información adicional
Size 100 uL
Gene Name PHF10
Gene Alias FLJ10975|MGC111009|XAP135
Gene Description PHD finger protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IP
Immunogen Prot. Seq MLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PHF10 (NP_060758.1, 1 a.a. ~ 410 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55274

Enviar un mensaje


PHF10 MaxPab rabbit polyclonal antibody (D01)

PHF10 MaxPab rabbit polyclonal antibody (D01)