ASXL2 MaxPab rabbit polyclonal antibody (D01)
  • ASXL2 MaxPab rabbit polyclonal antibody (D01)

ASXL2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055252-D01
ASXL2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ASXL2 protein.
Información adicional
Size 100 uL
Gene Name ASXL2
Gene Alias ASXH2|DKFZp686C1968|FLJ10898|KIAA1685
Gene Description additional sex combs like 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MKRTKCADIDVETPDSILVNTNLRALINKHTFSVLPGDCQQRLLLLLPEVDRQVGPDGLMKLNGSALNNEFFTSAAQGWKERLSEGEFTPEMQVRIRQEIEKEKKVEPWKEQFFESYYGQSSGLSLEDSKKLTASPSDPKVKKTPAEQPKSMPVSEASLIRIVPVVSQSECKEEALQMSSPGRKEECESQGEVQPNFSTSSEPLLSSALNTHELSSILPIKCPKDEDLLEQKPVTSAEQESEKNHLTTASNYNKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASXL2 (AAH42999.1, 1 a.a. ~ 918 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55252

Enviar un mensaje


ASXL2 MaxPab rabbit polyclonal antibody (D01)

ASXL2 MaxPab rabbit polyclonal antibody (D01)