Ver mas grande
FLJ10808 monoclonal antibody (M08), clone 1D11
AB-H00055236-M08
Producto nuevo
FLJ10808 monoclonal antibody (M08), clone 1D11
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | UBA6 |
| Gene Alias | FLJ10808|FLJ23367|MOP-4|UBE1L2 |
| Gene Description | ubiquitin-like modifier activating enzyme 6 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FLJ10808 (NP_060697, 962 a.a. ~ 1051 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 55236 |
| Clone Number | 1D11 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant FLJ10808.