PANK4 monoclonal antibody (M07), clone 2A11 Ver mas grande

PANK4 monoclonal antibody (M07), clone 2A11

AB-H00055229-M07

Producto nuevo

PANK4 monoclonal antibody (M07), clone 2A11

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name PANK4
Gene Alias DKFZp547M242|FLJ10782
Gene Description pantothenate kinase 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PANK4 (NP_060686.1, 673 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55229
Clone Number 2A11
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant PANK4.

Consulta sobre un producto

PANK4 monoclonal antibody (M07), clone 2A11

PANK4 monoclonal antibody (M07), clone 2A11