PANK4 monoclonal antibody (M07), clone 2A11
  • PANK4 monoclonal antibody (M07), clone 2A11

PANK4 monoclonal antibody (M07), clone 2A11

Ref: AB-H00055229-M07
PANK4 monoclonal antibody (M07), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PANK4.
Información adicional
Size 100 ug
Gene Name PANK4
Gene Alias DKFZp547M242|FLJ10782
Gene Description pantothenate kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PANK4 (NP_060686.1, 673 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55229
Clone Number 2A11
Iso type IgG2a Kappa

Enviar un mensaje


PANK4 monoclonal antibody (M07), clone 2A11

PANK4 monoclonal antibody (M07), clone 2A11