FLJ10774 polyclonal antibody (A01)
  • FLJ10774 polyclonal antibody (A01)

FLJ10774 polyclonal antibody (A01)

Ref: AB-H00055226-A01
FLJ10774 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FLJ10774.
Información adicional
Size 50 uL
Gene Name NAT10
Gene Alias ALP|DKFZp434C116|FLJ10774|FLJ12179|FLJ23850|KIAA1709|hALP
Gene Description N-acetyltransferase 10 (GCN5-related)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLJ10774 (NP_078938, 2 a.a. ~ 98 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55226

Enviar un mensaje


FLJ10774 polyclonal antibody (A01)

FLJ10774 polyclonal antibody (A01)