ETNK2 purified MaxPab mouse polyclonal antibody (B01P)
  • ETNK2 purified MaxPab mouse polyclonal antibody (B01P)

ETNK2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055224-B01P
ETNK2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ETNK2 protein.
Información adicional
Size 50 ug
Gene Name ETNK2
Gene Alias EKI2|FLJ10761|HMFT1716
Gene Description ethanolamine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ETNK2 (AAH10082.1, 1 a.a. ~ 386 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55224

Enviar un mensaje


ETNK2 purified MaxPab mouse polyclonal antibody (B01P)

ETNK2 purified MaxPab mouse polyclonal antibody (B01P)