RCBTB1 monoclonal antibody (M07), clone 1E4
  • RCBTB1 monoclonal antibody (M07), clone 1E4

RCBTB1 monoclonal antibody (M07), clone 1E4

Ref: AB-H00055213-M07
RCBTB1 monoclonal antibody (M07), clone 1E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RCBTB1.
Información adicional
Size 100 ug
Gene Name RCBTB1
Gene Alias CLLD7|CLLL7|GLP|MGC33184|RP11-185C18.1
Gene Description regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCBTB1 (NP_060661.3, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55213
Clone Number 1E4
Iso type IgG1 Kappa

Enviar un mensaje


RCBTB1 monoclonal antibody (M07), clone 1E4

RCBTB1 monoclonal antibody (M07), clone 1E4