ARL8B monoclonal antibody (M01), clone 1A2
  • ARL8B monoclonal antibody (M01), clone 1A2

ARL8B monoclonal antibody (M01), clone 1A2

Ref: AB-H00055207-M01
ARL8B monoclonal antibody (M01), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ARL8B.
Información adicional
Size 100 ug
Gene Name ARL8B
Gene Alias ARL10C|FLJ10702|Gie1
Gene Description ADP-ribosylation factor-like 8B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARL8B (AAH13131, 1 a.a. ~ 186 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55207
Clone Number 1A2
Iso type IgG2a Kappa

Enviar un mensaje


ARL8B monoclonal antibody (M01), clone 1A2

ARL8B monoclonal antibody (M01), clone 1A2