MAP1S purified MaxPab mouse polyclonal antibody (B01P)
  • MAP1S purified MaxPab mouse polyclonal antibody (B01P)

MAP1S purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055201-B01P
MAP1S purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAP1S protein.
Información adicional
Size 50 ug
Gene Name MAP1S
Gene Alias BPY2IP1|C19orf5|FLJ10669|MAP8|MGC133087|VCY2IP-1|VCY2IP1
Gene Description microtubule-associated protein 1S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVFVSRHSATFSSIVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGPCLEETGELLLQTGGFSPHHFLQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALRLQLRLNPPAQLPNSEGLCEFLEYVAESLEPPSPFELLEPPTSGGFLRLGRPCCYIFPGGLGDAAF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAP1S (AAH80547.1, 1 a.a. ~ 1059 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55201

Enviar un mensaje


MAP1S purified MaxPab mouse polyclonal antibody (B01P)

MAP1S purified MaxPab mouse polyclonal antibody (B01P)