APPL2 monoclonal antibody (M06), clone 1C10
  • APPL2 monoclonal antibody (M06), clone 1C10

APPL2 monoclonal antibody (M06), clone 1C10

Ref: AB-H00055198-M06
APPL2 monoclonal antibody (M06), clone 1C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant APPL2.
Información adicional
Size 100 ug
Gene Name APPL2
Gene Alias DIP13B|FLJ10659
Gene Description adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APPL2 (NP_060641.2, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55198
Clone Number 1C10
Iso type IgG2b Kappa

Enviar un mensaje


APPL2 monoclonal antibody (M06), clone 1C10

APPL2 monoclonal antibody (M06), clone 1C10