RPRD1A monoclonal antibody (M02A), clone 1B9
  • RPRD1A monoclonal antibody (M02A), clone 1B9

RPRD1A monoclonal antibody (M02A), clone 1B9

Ref: AB-H00055197-M02A
RPRD1A monoclonal antibody (M02A), clone 1B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPRD1A.
Información adicional
Size 200 uL
Gene Name RPRD1A
Gene Alias FLJ10656|HsT3101|MGC19513|P15RS
Gene Description regulation of nuclear pre-mRNA domain containing 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 55197
Clone Number 1B9
Iso type IgG2b Kappa

Enviar un mensaje


RPRD1A monoclonal antibody (M02A), clone 1B9

RPRD1A monoclonal antibody (M02A), clone 1B9