Ver mas grande
NADSYN1 polyclonal antibody (A01)
AB-H00055191-A01
Producto nuevo
NADSYN1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | NADSYN1 |
| Gene Alias | FLJ10631|FLJ36703|FLJ40627 |
| Gene Description | NAD synthetase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | KMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NADSYN1 (NP_004981, 609 a.a. ~ 706 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 55191 |
Más información
Mouse polyclonal antibody raised against a partial recombinant NADSYN1.