FLJ10597 monoclonal antibody (M01), clone 5E5
  • FLJ10597 monoclonal antibody (M01), clone 5E5

FLJ10597 monoclonal antibody (M01), clone 5E5

Ref: AB-H00055182-M01
FLJ10597 monoclonal antibody (M01), clone 5E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FLJ10597.
Información adicional
Size 100 ug
Gene Name RNF220
Gene Alias C1orf164|FLJ10597
Gene Description ring finger protein 220
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLJ10597 (NP_060620, 468 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55182
Clone Number 5E5
Iso type IgG1 Kappa

Enviar un mensaje


FLJ10597 monoclonal antibody (M01), clone 5E5

FLJ10597 monoclonal antibody (M01), clone 5E5