PRMT6 MaxPab rabbit polyclonal antibody (D01)
  • PRMT6 MaxPab rabbit polyclonal antibody (D01)

PRMT6 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055170-D01
PRMT6 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRMT6 protein.
Información adicional
Size 100 uL
Gene Name PRMT6
Gene Alias FLJ10559|HRMT1L6
Gene Description protein arginine methyltransferase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRMT6 (NP_060607.1, 1 a.a. ~ 316 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55170

Enviar un mensaje


PRMT6 MaxPab rabbit polyclonal antibody (D01)

PRMT6 MaxPab rabbit polyclonal antibody (D01)