MSL2 monoclonal antibody (M01), clone 3A4
  • MSL2 monoclonal antibody (M01), clone 3A4

MSL2 monoclonal antibody (M01), clone 3A4

Ref: AB-H00055167-M01
MSL2 monoclonal antibody (M01), clone 3A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MSL2.
Información adicional
Size 100 ug
Gene Name MSL2
Gene Alias FLJ10546|KIAA1585|MSL-2|MSL2L1|RNF184
Gene Description male-specific lethal 2 homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MSL2 (NP_060603, 478 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55167
Clone Number 3A4
Iso type IgG1 Kappa

Enviar un mensaje


MSL2 monoclonal antibody (M01), clone 3A4

MSL2 monoclonal antibody (M01), clone 3A4