DARS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • DARS2 purified MaxPab rabbit polyclonal antibody (D01P)

DARS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055157-D01P
DARS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DARS2 protein.
Información adicional
Size 100 ug
Gene Name DARS2
Gene Alias ASPRS|FLJ10514|LBSL|MT-ASPRS|RP3-383J4.2
Gene Description aspartyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DARS2 (NP_060592.2, 1 a.a. ~ 645 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55157

Enviar un mensaje


DARS2 purified MaxPab rabbit polyclonal antibody (D01P)

DARS2 purified MaxPab rabbit polyclonal antibody (D01P)