DALRD3 purified MaxPab mouse polyclonal antibody (B01P)
  • DALRD3 purified MaxPab mouse polyclonal antibody (B01P)

DALRD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055152-B01P
DALRD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DALRD3 protein.
Información adicional
Size 50 ug
Gene Name DALRD3
Gene Alias FLJ10496
Gene Description DALR anticodon binding domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MATRRLGVGETLGALNAALGPGGPVWIKETRTRHLRSRDFLAPHRALQARFDDGQVPEHLLHALACLQGPGVAPVLRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPASLGQRVLLHCPALRSSPCALRLSQLRTVLVADHLARALRAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSHALEELTSANDGRTLSPGILGRLCLKELVEEQGRTAGYDPNLDNCLVTEDLLSVLAELQEAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DALRD3 (NP_001009996.1, 1 a.a. ~ 543 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55152

Enviar un mensaje


DALRD3 purified MaxPab mouse polyclonal antibody (B01P)

DALRD3 purified MaxPab mouse polyclonal antibody (B01P)