CEP27 purified MaxPab mouse polyclonal antibody (B01P)
  • CEP27 purified MaxPab mouse polyclonal antibody (B01P)

CEP27 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055142-B01P
CEP27 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CEP27 protein.
Información adicional
Size 50 ug
Gene Name CEP27
Gene Alias C15orf25|FLJ10460|HsT17025
Gene Description centrosomal protein 27kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CEP27 (NP_060567, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55142

Enviar un mensaje


CEP27 purified MaxPab mouse polyclonal antibody (B01P)

CEP27 purified MaxPab mouse polyclonal antibody (B01P)