ELP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ELP3 purified MaxPab rabbit polyclonal antibody (D01P)

ELP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055140-D01P
ELP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ELP3 protein.
Información adicional
Size 100 ug
Gene Name ELP3
Gene Alias FLJ10422|KAT9
Gene Description elongation protein 3 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELP3 (NP_060561.3, 1 a.a. ~ 547 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55140

Enviar un mensaje


ELP3 purified MaxPab rabbit polyclonal antibody (D01P)

ELP3 purified MaxPab rabbit polyclonal antibody (D01P)