SRBD1 purified MaxPab mouse polyclonal antibody (B01P)
  • SRBD1 purified MaxPab mouse polyclonal antibody (B01P)

SRBD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055133-B01P
SRBD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SRBD1 protein.
Información adicional
Size 50 ug
Gene Name SRBD1
Gene Alias FLJ10379
Gene Description S1 RNA binding domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MIAKDKDTLDFIRNLCQKRHVCIQSSLAKVSSKKVNEKDVDKFLLYQHFSCNIRNIHHHQILAINRGENLKVLTVKVNISDGVKDEFCRWCIQNRWRPRSFARPELMKILYNSLNDSFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQILHTDVVYLHCGQGFREAEKIKTLLLNFNCSTVVIGNGTACRETEAYFADLIMKNYFAPLDVVYCIVSEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRBD1 (AAH32538.1, 1 a.a. ~ 620 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55133

Enviar un mensaje


SRBD1 purified MaxPab mouse polyclonal antibody (B01P)

SRBD1 purified MaxPab mouse polyclonal antibody (B01P)