TRIM68 monoclonal antibody (M01), clone 5G2
  • TRIM68 monoclonal antibody (M01), clone 5G2

TRIM68 monoclonal antibody (M01), clone 5G2

Ref: AB-H00055128-M01
TRIM68 monoclonal antibody (M01), clone 5G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM68.
Información adicional
Size 100 ug
Gene Name TRIM68
Gene Alias FLJ10369|MGC126176|RNF137|SS-56
Gene Description tripartite motif-containing 68
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM68 (NP_060543, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55128
Clone Number 5G2
Iso type IgG2a Kappa

Enviar un mensaje


TRIM68 monoclonal antibody (M01), clone 5G2

TRIM68 monoclonal antibody (M01), clone 5G2