TAPBPL monoclonal antibody (M02), clone 6E3
  • TAPBPL monoclonal antibody (M02), clone 6E3

TAPBPL monoclonal antibody (M02), clone 6E3

Ref: AB-H00055080-M02
TAPBPL monoclonal antibody (M02), clone 6E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TAPBPL.
Información adicional
Size 100 ug
Gene Name TAPBPL
Gene Alias FLJ10143|TAPBP-R|TAPBPR
Gene Description TAP binding protein-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAPBPL (NP_060479, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55080
Clone Number 6E3
Iso type IgG2a Kappa

Enviar un mensaje


TAPBPL monoclonal antibody (M02), clone 6E3

TAPBPL monoclonal antibody (M02), clone 6E3