TAPBPL purified MaxPab rabbit polyclonal antibody (D01P)
  • TAPBPL purified MaxPab rabbit polyclonal antibody (D01P)

TAPBPL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055080-D01P
TAPBPL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAPBPL protein.
Información adicional
Size 100 ug
Gene Name TAPBPL
Gene Alias FLJ10143|TAPBP-R|TAPBPR
Gene Description TAP binding protein-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAAWFMANVQVSGGGPSISLVMKTPRVAKNEVLWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAPBPL (NP_060479.2, 1 a.a. ~ 468 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55080

Enviar un mensaje


TAPBPL purified MaxPab rabbit polyclonal antibody (D01P)

TAPBPL purified MaxPab rabbit polyclonal antibody (D01P)