ZWILCH monoclonal antibody (M11), clone 1C10
  • ZWILCH monoclonal antibody (M11), clone 1C10

ZWILCH monoclonal antibody (M11), clone 1C10

Ref: AB-H00055055-M11
100 ug

Información del producto

ZWILCH monoclonal antibody (M11), clone 1C10
Información adicional
Size 100 ug
Gene Name ZWILCH
Gene Alias FLJ10036|FLJ16343|KNTC1AP|MGC111034|hZwilch
Gene Description Zwilch, kinetochore associated, homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZWILCH (AAH36900, 1 a.a. ~ 477 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55055
Clone Number 1C10
Iso type IgG1 Kappa

Enviar un mensaje


ZWILCH monoclonal antibody (M11), clone 1C10

ZWILCH monoclonal antibody (M11), clone 1C10