ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)
  • ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)

ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055055-D01P
100 ug

Información del producto

ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name ZWILCH
Gene Alias FLJ10036|FLJ16343|KNTC1AP|MGC111034|hZwilch
Gene Description Zwilch, kinetochore associated, homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZWILCH (AAH36900.1, 1 a.a. ~ 477 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55055

Enviar un mensaje


ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)

ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)