PHIP polyclonal antibody (A01)
  • PHIP polyclonal antibody (A01)

PHIP polyclonal antibody (A01)

Ref: AB-H00055023-A01
PHIP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PHIP.
Información adicional
Size 50 uL
Gene Name PHIP
Gene Alias FLJ20705|FLJ45918|MGC90216|WDR11|ndrp
Gene Description pleckstrin homology domain interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHIP (NP_060404, 1599 a.a. ~ 1705 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55023

Enviar un mensaje


PHIP polyclonal antibody (A01)

PHIP polyclonal antibody (A01)