MARCH1 monoclonal antibody (M02), clone 3D2
  • MARCH1 monoclonal antibody (M02), clone 3D2

MARCH1 monoclonal antibody (M02), clone 3D2

Ref: AB-H00055016-M02
MARCH1 monoclonal antibody (M02), clone 3D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARCH1.
Información adicional
Size 100 ug
Gene Name MARCH1
Gene Alias DKFZp564M1682|FLJ20668|MARCH-I|RNF171
Gene Description membrane-associated ring finger (C3HC4) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCH1 (NP_060393, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55016
Clone Number 3D2
Iso type IgG2a Kappa

Enviar un mensaje


MARCH1 monoclonal antibody (M02), clone 3D2

MARCH1 monoclonal antibody (M02), clone 3D2