MARCH1 polyclonal antibody (A01)
  • MARCH1 polyclonal antibody (A01)

MARCH1 polyclonal antibody (A01)

Ref: AB-H00055016-A01
MARCH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MARCH1.
Información adicional
Size 50 uL
Gene Name MARCH1
Gene Alias DKFZp564M1682|FLJ20668|MARCH-I|RNF171
Gene Description membrane-associated ring finger (C3HC4) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCH1 (NP_060393, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55016

Enviar un mensaje


MARCH1 polyclonal antibody (A01)

MARCH1 polyclonal antibody (A01)