Ver mas grande
MARCH1 polyclonal antibody (A01)
AB-H00055016-A01
Producto nuevo
MARCH1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | MARCH1 |
| Gene Alias | DKFZp564M1682|FLJ20668|MARCH-I|RNF171 |
| Gene Description | membrane-associated ring finger (C3HC4) 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MARCH1 (NP_060393, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 55016 |
Más información
Mouse polyclonal antibody raised against a partial recombinant MARCH1.