PPP2R3C purified MaxPab mouse polyclonal antibody (B01P)
  • PPP2R3C purified MaxPab mouse polyclonal antibody (B01P)

PPP2R3C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055012-B01P
PPP2R3C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP2R3C protein.
Información adicional
Size 50 ug
Gene Name PPP2R3C
Gene Alias C14orf10|FLJ20644|G4-1|G5pr
Gene Description protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENFLKVGEKAGAKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP2R3C (NP_060387.2, 1 a.a. ~ 453 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55012

Enviar un mensaje


PPP2R3C purified MaxPab mouse polyclonal antibody (B01P)

PPP2R3C purified MaxPab mouse polyclonal antibody (B01P)