AURKAIP1 purified MaxPab mouse polyclonal antibody (B01P)
  • AURKAIP1 purified MaxPab mouse polyclonal antibody (B01P)

AURKAIP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054998-B01P
AURKAIP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AURKAIP1 protein.
Información adicional
Size 50 ug
Gene Name AURKAIP1
Gene Alias AIP|AKIP|FLJ20608
Gene Description aurora kinase A interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AURKAIP1 (NP_060370.1, 1 a.a. ~ 199 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54998

Enviar un mensaje


AURKAIP1 purified MaxPab mouse polyclonal antibody (B01P)

AURKAIP1 purified MaxPab mouse polyclonal antibody (B01P)