ULK4 monoclonal antibody (M01), clone 4A10-1A7
  • ULK4 monoclonal antibody (M01), clone 4A10-1A7

ULK4 monoclonal antibody (M01), clone 4A10-1A7

Ref: AB-H00054986-M01
ULK4 monoclonal antibody (M01), clone 4A10-1A7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ULK4.
Información adicional
Size 100 ug
Gene Name ULK4
Gene Alias DKFZp434E1822|FAM7C1|FLJ20574|REC01035
Gene Description unc-51-like kinase 4 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLTREIKHKNIVTFHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNFCLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEVVRGADFSISSDLWSLGCLLYEMFSGKPPFFSESISELTEKILCEDPLPPIPKDSSRPKASSDFIN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ULK4 (AAH14794, 1 a.a. ~ 580 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54986
Clone Number 4A10-1A7
Iso type IgG1 kappa

Enviar un mensaje


ULK4 monoclonal antibody (M01), clone 4A10-1A7

ULK4 monoclonal antibody (M01), clone 4A10-1A7