PINX1 polyclonal antibody (A01)
  • PINX1 polyclonal antibody (A01)

PINX1 polyclonal antibody (A01)

Ref: AB-H00054984-A01
PINX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PINX1.
Información adicional
Size 50 uL
Gene Name PINX1
Gene Alias FLJ20565|LPTL|LPTS|MGC8850
Gene Description PIN2-interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PINX1 (AAH15479, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54984

Enviar un mensaje


PINX1 polyclonal antibody (A01)

PINX1 polyclonal antibody (A01)