ICF45 purified MaxPab mouse polyclonal antibody (B01P)
  • ICF45 purified MaxPab mouse polyclonal antibody (B01P)

ICF45 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054974-B01P
ICF45 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ICF45 protein.
Información adicional
Size 50 ug
Gene Name THG1L
Gene Alias FLJ11601|FLJ20546|ICF45
Gene Description tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ICF45 (AAH23521.1, 1 a.a. ~ 298 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54974

Enviar un mensaje


ICF45 purified MaxPab mouse polyclonal antibody (B01P)

ICF45 purified MaxPab mouse polyclonal antibody (B01P)