TTC12 purified MaxPab rabbit polyclonal antibody (D01P)
  • TTC12 purified MaxPab rabbit polyclonal antibody (D01P)

TTC12 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054970-D01P
TTC12 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TTC12 protein.
Información adicional
Size 100 ug
Gene Name TTC12
Gene Alias FLJ13859|FLJ20535|TPARM
Gene Description tetratricopeptide repeat domain 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDADKEKDLQKFLKNVDEISNLIQEMNSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQTALKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWALKCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINPKLQTQVKGYLNQVDLQEKADLQEKEAHELLDSGKNTAVTTKNLLETLSKP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC12 (AAH32355.1, 1 a.a. ~ 732 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54970

Enviar un mensaje


TTC12 purified MaxPab rabbit polyclonal antibody (D01P)

TTC12 purified MaxPab rabbit polyclonal antibody (D01P)