SSH3 polyclonal antibody (A01)
  • SSH3 polyclonal antibody (A01)

SSH3 polyclonal antibody (A01)

Ref: AB-H00054961-A01
SSH3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SSH3.
Información adicional
Size 50 uL
Gene Name SSH3
Gene Alias FLJ10928|FLJ20515|SSH-3
Gene Description slingshot homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SSH3 (NP_060327, 293 a.a. ~ 391 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54961

Enviar un mensaje


SSH3 polyclonal antibody (A01)

SSH3 polyclonal antibody (A01)